में अनुक्रमित
  • अकादमिक जर्नल डेटाबेस
  • जेनेमिक्स जर्नलसीक
  • शैक्षणिक कुंजी
  • जर्नल टीओसी
  • चीन राष्ट्रीय ज्ञान अवसंरचना (सीएनकेआई)
  • Scimago
  • कृषि में वैश्विक ऑनलाइन अनुसंधान तक पहुंच (अगोरा)
  • इलेक्ट्रॉनिक जर्नल्स लाइब्रेरी
  • RefSeek
  • रिसर्च जर्नल इंडेक्सिंग की निर्देशिका (डीआरजेआई)
  • हमदर्द विश्वविद्यालय
  • ईबीएससीओ एज़
  • ओसीएलसी- वर्ल्डकैट
  • एसडब्ल्यूबी ऑनलाइन कैटलॉग
  • जीव विज्ञान की वर्चुअल लाइब्रेरी (विफैबियो)
  • पबलोन्स
  • मियार
  • विश्वविद्यालय अनुदान आयोग
  • चिकित्सा शिक्षा और अनुसंधान के लिए जिनेवा फाउंडेशन
  • यूरो पब
  • गूगल ज्ञानी
इस पृष्ठ को साझा करें
जर्नल फ़्लायर
Flyer image

अमूर्त

Purification, Amino Acid sequencing and Thermostability of an Extracellular Low Molecular Weight Esterase Produced by Bacillus Subtilis NRRL 41270 in Fermentation

Papagianni M and Papamichael EM

Extracellular esterase activity in Bacillus subtilis NRRL 41270 fermentation broths was found to reside in a small protein with a molecular weight less than 10 kDa. Following purification, esterase activity on fluorescein dibutyrate was estimated at 12 U/min/mg proteins. Enzyme saturation was observed at 5 μM substrate concentration. The produced esterase hydrolysed tributyrin. Its specific activity was estimated to be 17.8 μmol acid released/min/mg proteins. The small protein was subjected to size exclusion chromatography, SDS-PAGE and amino acid sequencing. Analysis revealed a sequence of the following amino acid residues: eevaetysfyhitphdystshispapvqffspap, according to which the molecule has 34 amino acid residues and a calculated molecular mass of 3853, which was in accordance with the gel filtration and SDS-PAGE results. Sequence based analysis and use of bioinformatics tools showed no significant similarity with known proteins while revealed a strongly hydrophobic molecule, with a α-helical conformation in the N-terminal, the rest of the molecule being β-sheet-rich. The enzyme appeared to be thermostable with more than 85% of the original activity maintained after 120 h incubation at 60°C. The producer organism and the features of the micro enzyme, suggest the case of a biotechnologically interesting biocatalyst that should be further researched in terms of its stability and production characteristics.

अस्वीकृति: इस सारांश का अनुवाद कृत्रिम बुद्धिमत्ता उपकरणों का उपयोग करके किया गया है और इसे अभी तक समीक्षा या सत्यापित नहीं किया गया है।